|All Peptides

Thymosin Beta-4

A full-spectrum healing peptide for tissue repair, cardiac support, and hair growth. Thymosin Beta-4 (TB-4) is the full-length 43 amino acid peptide naturally found in human tissues, particularly the thymus gland. It plays a crucial role in tissue repair, wound healing, cell migration, angiogenesis, and immune regulation. More biologically complete than TB-500, it interacts with multiple pathways for superior regenerative effects. Often stacked with BPC-157 for comprehensive healing.

Compare Prices
🧬Key Characteristics
  • Length: 43 amino acids
    (Full-length native peptide.)
  • Origin: Thymus gland
    (Naturally produced in many tissues.)
  • Mechanism: Multi-pathway
    (Actin binding, angiogenesis, immune modulation.)
  • vs TB-500: More complete
    (Full bioactivity vs fragment.)
Full sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
The complete Thymosin Beta-4 sequence includes the LKKTETQ active region plus additional amino acids that contribute to its full biological activity and multi-pathway effects.
Key takeaway: Thymosin Beta-4 is the full-length version of TB-500 with complete biological activity. Often stacked with BPC-157 for comprehensive healing — BPC-157 for local repair and TB-4 for systemic regeneration.

Overview

Core Benefits

Key Advantages
Tissue repair
Studied for accelerating healing of tendons, ligaments, muscles, and other tissues.
Anti-inflammatory
May help reduce inflammation at injury sites and throughout the body.
Wound healing
Research shows potential for faster wound closure and tissue regeneration.
Gut health
Some healing peptides show benefits for gut lining and digestive health.
Joint support
May support joint comfort and mobility during recovery.
Synergistic stacking
Often combined with other healing peptides for comprehensive recovery.

These are educational summaries of commonly discussed effects in wellness/regenerative contexts, not guarantees.

Thymosin Beta-4 Results Timeline

Progression
1
Week 1–2
Physical Changes
Initial inflammatory response modulation, early tissue repair signals
Performance & Recovery
May notice reduced discomfort at injury sites
Other Benefits
Improved gut comfort (if applicable), better sleep quality
2
Week 3–4
Physical Changes
Visible improvement in healing tissues, reduced swelling
Performance & Recovery
Increased mobility and flexibility in affected areas
Other Benefits
Enhanced recovery from workouts, improved overall well-being
3
Month 2–3
Physical Changes
Significant tissue repair progress, improved joint comfort
Performance & Recovery
Return to normal activity levels, reduced pain
Other Benefits
Systemic healing benefits, improved skin quality
4
3+ Months
Physical Changes
Near-complete healing of targeted tissues
Performance & Recovery
Full functional recovery in many cases
Other Benefits
Cumulative benefits build over multiple 8-week on/off cycles; many see best results with 2-3 cycles

Timeline is illustrative and non-guaranteed. Outcomes vary and are commonly discussed alongside training, nutrition, sleep, and cycling practices.

How It Works

Healing Peptide — Full-Length Thymosin Beta-4

Target → Repair Signal → Tissue Healing → Outcomes

🎯
Target

G-Actin (Cytoskeletal Protein) — Full Molecule

Thymosin Beta-4 is the full 43-amino-acid protein from which TB-500 is derived. It contains the same actin-binding domain plus additional sequences that may provide broader biological activity, including immune modulation and cardiac repair.

Cellular Signal

Actin Regulation + Extended Signaling Domains

Same core actin-sequestering mechanism as TB-500, but the full-length molecule provides additional signaling capabilities. The extra amino acid sequences interact with more cellular pathways, potentially offering more comprehensive healing and immune effects.

🔄
Systemic Effect

Comprehensive Healing + Immune + Cardiac Support

Tissue repair, anti-inflammation, and cell migration (like TB-500), plus enhanced immune modulation and cardioprotective effects from the additional protein domains. Research shows particular promise for cardiac tissue repair after injury.

What You Notice

Similar to TB-500 with Broader Effects

Healing and anti-inflammatory effects similar to TB-500. Some users report more comprehensive results, particularly for complex or multi-system injuries. Often chosen when maximum healing support is desired. Stacks well with BPC-157.

What Makes This Peptide Different

Thymosin Beta-4 is the full-length parent molecule of TB-500. While TB-500 contains the key actin-binding fragment, Thymosin Beta-4 includes additional sequences that may provide broader healing, immune, and cardioprotective effects. The tradeoff: higher cost and potentially less targeted action compared to TB-500's focused fragment.

Dosing Protocol

Healing / Tissue Repair

Educational reference only. Individual responses vary. Consult healthcare provider before use.

Vial Size
5 mg
Reconstitution
2 ml BAC water
Dose
500 mcg - 1 mg
Timing
AM
Frequency
Daily during loading, then 2x/week
Duration
4-8 weeks
Protocol Notes
Full-length version of TB-500. Same loading/maintenance protocol. More comprehensive healing effects.
Read the full dosing guide — protocols, reconstitution, clinical context & more

Popular Stack Protocols

1 stack

Commonly paired protocols from the peptide research community. Educational reference only.

🧬 BPC-157 + TB-4 (Full-Length)

Healing / Tissue Repair
Dose
500 mcg
Vial Size
10 mg
Reconstitution
2 ml BAC water
Dose
500 mcg – 1 mg
Vial Size
5 mg
Reconstitution
2 ml BAC water
Timing
AM (can split AM/PM)
Frequency
TB-4: daily loading (2 weeks), then 2x/week. BPC-157: daily throughout.
Duration
4–8 weeks
Full-length TB-4 includes the TB-500 active fragment plus additional sequences that activate cardiac progenitor cells and hair follicle stem cells. More comprehensive healing than the TB-500 variant. Loading phase for TB-4 is important to saturate tissue levels before tapering to maintenance.

Why This Dosing Protocol

Why same protocol as TB-500? Both work through actin regulation with systemic distribution. Loading phase (daily 2-4 weeks) followed by maintenance (2x/week) is the standard approach.

TB-500 vs Thymosin Beta-4: TB-500 is the targeted fragment — sufficient for most healing needs. Full Thymosin Beta-4 is chosen for complex injuries or when maximum healing support is desired.

Thymosin Beta-4 Pricing

We surface in-stock offers first and normalize by price per mg for quick comparisons.

Look for the COA ribbon on cards.

Looking for medical guidance?

Join the waitlist for doctor-guided peptide plans. We'll notify you when telehealth consultations are available in your state.

Stacks

Thymosin Beta-4 is commonly paired with ipamorelin in GH-axis research discussions. For comparing bundles fairly, we normalize stack value using the Thymosin Beta-4 amount as the driving peptide (assuming ratios remain consistent as bundle sizes scale).

BPC-157 + Thymosin Beta-4

Sorted by cost per mg of CJC. COA = Certificate of Analysis (vendor-provided lab documentation).
VendorStackPrice$/mg (CJC)COALink
EZ Peptides5mg/5mg$48.00$9.60Go →

Reconstitution calculator

Dilution math and unit conversions. Prefilled using a common vial size for this peptide.

Open calculator

Educational Videos

How to Reconstitute Peptides

Handling

Educational overview on storage, labeling, and traceability considerations for lab environments. Consult primary literature and vendor documentation for specifics.

Powder Storage (Very Stable)
  • Freezer (-20°C): 1+ year ✓
  • Refrigerator (2-8°C): 1-3 months ✓
  • Room temperature: 2-3 weeks (emergency only)
Reconstituted Storage (Fragile)
  • MUST refrigerate at 2-8°C
  • 4-week maximum shelf life
  • NEVER freeze after reconstitution
  • Use bacteriostatic water for multi-dose

Storage & Handling Guide

Learn proper storage temperatures, shelf life timelines, reconstitution best practices, and travel tips for lyophilized and reconstituted peptides.

Powder: Freezer
1+ year at -20°C
Reconstituted: Fridge
4 weeks max at 2-8°C
View Complete Storage Guide

FAQ

What is Thymosin Beta-4 and how does it differ from TB-500?

Thymosin Beta-4 (TB-4) is the full-length 43-amino acid peptide naturally found in human tissues. TB-500 is a synthetic fragment of TB-4 designed to be more affordable. TB-4 offers complete biological activity across multiple regenerative pathways, while TB-500 captures only part of that activity. TB-4 is considered more potent but costs more.

Why would someone choose TB-4 over TB-500?

TB-4 is the full-length, biologically complete peptide that interacts with more pathways than the TB-500 fragment. Researchers choose TB-4 when they want maximum regenerative potential and full multi-pathway activity (tissue repair, angiogenesis, immune modulation). TB-500 is chosen when cost is a primary factor.

Is Thymosin Beta-4 commonly stacked with BPC-157?

Yes, the TB-4 + BPC-157 stack is one of the most popular healing combinations in peptide research. BPC-157 provides localized healing at injury sites, while TB-4 provides systemic regeneration throughout the body. Together they're discussed for comprehensive tissue repair, tendon/ligament healing, and faster recovery.

How does Thymosin Beta-4 work?

TB-4 sequesters G-actin, regulating the actin cytoskeleton essential for cell movement. This promotes cell migration to injury sites. It also stimulates angiogenesis, reduces inflammation, has antimicrobial properties, and modulates immune responses. Its multi-pathway activity explains its broad healing capabilities.

What is the typical Thymosin Beta-4 dosage?

A common protocol uses 500 mcg to 1 mg per injection daily during the cycle. Protocol: 8 weeks on, 8 weeks off. As the full-length version of TB-500, TB-4 provides more comprehensive healing effects.

What conditions is Thymosin Beta-4 researched for?

Research areas include wound healing, cardiac repair (post-heart attack), corneal injury, neurological injury, muscle repair, and hair growth. TB-4 has been in clinical trials for wound healing and cardiac conditions. Its broad regenerative effects make it relevant for many tissue repair applications.

Does Thymosin Beta-4 have cardiac benefits?

Yes, TB-4 has shown cardioprotective effects in research. It can activate cardiac progenitor cells, promote new blood vessel formation in the heart, and reduce scarring after heart attacks. Clinical trials have explored its use for cardiac repair, showing promise for improving heart function post-injury.

What are the side effects of Thymosin Beta-4?

TB-4 is generally well-tolerated as it's a naturally occurring peptide. Possible side effects include temporary fatigue, head rush, and injection site reactions. Like other healing peptides, there are theoretical concerns about tumor growth promotion, though research has not confirmed this risk.

How long does reconstituted peptide last?

Once mixed with bacteriostatic water, peptides remain stable for up to 4 weeks when refrigerated at 2-8°C (36-46°F). Unopened powder can last 1+ year in the freezer. Get our complete Storage & Travel Guide.

Is this peptide legal to purchase?

Peptides sold "for research purposes only" are legal to purchase in the US, but are not FDA-approved for human use outside of specific medical applications. Always consult a healthcare provider before use.

New to peptides?

Take our Peptide Match tool to find the best peptide for your goals. You can also read our Complete Guide to Peptides to learn the basics.

Scientific Sources

The following peer-reviewed studies and official resources provide additional scientific context for this peptide:

Disclosure: we may earn affiliate commission from qualifying purchases. Educational information only — not medical advice.